Recombinant Human MED4, His-tagged

Cat.No. : MED4-29557TH
Product Overview : Recombinant fragment, corresponding to amino acids 24-270 of Human MED4 with an N-terminal His tag; Predicted MWt 29 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-270 a.a.
Description : The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 94 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEEN QVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVE KRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKAR KGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYP TDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLA PQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDV EIMSTDSSSSSSESD
Sequence Similarities : Belongs to the Mediator complex subunit 4 family.
Gene Name MED4 mediator complex subunit 4 [ Homo sapiens ]
Official Symbol MED4
Synonyms MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36;
Gene ID 29079
mRNA Refseq NM_014166
Protein Refseq NP_054885
MIM 605718
Uniprot ID Q9NPJ6
Chromosome Location 13q14.12
Pathway Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function RNA polymerase II transcription cofactor activity; RNA polymerase II transcription cofactor activity; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED4 Products

Required fields are marked with *

My Review for All MED4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon