Recombinant Human MED4, His-tagged
| Cat.No. : | MED4-29557TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 24-270 of Human MED4 with an N-terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-270 a.a. |
| Description : | The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 94 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEEN QVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVE KRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKAR KGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYP TDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLA PQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDV EIMSTDSSSSSSESD |
| Sequence Similarities : | Belongs to the Mediator complex subunit 4 family. |
| Gene Name | MED4 mediator complex subunit 4 [ Homo sapiens ] |
| Official Symbol | MED4 |
| Synonyms | MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36; |
| Gene ID | 29079 |
| mRNA Refseq | NM_014166 |
| Protein Refseq | NP_054885 |
| MIM | 605718 |
| Uniprot ID | Q9NPJ6 |
| Chromosome Location | 13q14.12 |
| Pathway | Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem; |
| Function | RNA polymerase II transcription cofactor activity; RNA polymerase II transcription cofactor activity; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED4 Products
Required fields are marked with *
My Review for All MED4 Products
Required fields are marked with *
