Recombinant Human MED4 Protein, GST-tagged
Cat.No. : | MED4-4467H |
Product Overview : | Human MED4 full-length ORF ( AAH05189, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 55.44 kDa |
AA Sequence : | MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED4 mediator complex subunit 4 [ Homo sapiens ] |
Official Symbol | MED4 |
Synonyms | MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36; TRAP/SMCC/PC2 subunit p36 subunit; activator-recruited cofactor 36 kDa component; mediator of RNA polymerase II transcription, subunit 4 homolog; vitamin D3 receptor-interacting protein complex 36 kDa component; ARC36; VDRIP; RP11-90M2.2; FLJ10956; |
Gene ID | 29079 |
mRNA Refseq | NM_014166 |
Protein Refseq | NP_054885 |
MIM | 605718 |
UniProt ID | Q9NPJ6 |
◆ Recombinant Proteins | ||
MED4-9704M | Recombinant Mouse MED4 Protein | +Inquiry |
MED4-29557TH | Recombinant Human MED4, His-tagged | +Inquiry |
MED4-5201H | Recombinant Human MED4 protein, His-tagged | +Inquiry |
MED4-5460M | Recombinant Mouse MED4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Med4-4021M | Recombinant Mouse Med4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED4-4381HCL | Recombinant Human MED4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED4 Products
Required fields are marked with *
My Review for All MED4 Products
Required fields are marked with *