"MED6" Related Products

Expand

Recombinant Human MED6 protein, T7-tagged

Cat.No.: MED6-131H
Product Overview: Recombinant human MED6 ( 157aa, Isoform-II ) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSA FDEAMSYCRYHPSKGYWWHFKDHEEQGK
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: MED6 mediator complex subunit 6 [ Homo sapiens ]
Official Symbol: MED6
Synonyms: MED6; mediator complex subunit 6; mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 6; NY REN 28; ARC33; hMed6; renal carcinoma antigen NY-REN-28; activator-recruited cofactor 33 kDa component; mediator of RNA polymerase II transcription, subunit 6 homolog; NY-REN-28;
Gene ID: 10001
mRNA Refseq: NM_005466
Protein Refseq: NP_005457
MIM: 602984
UniProt ID: O75586
Chromosome Location: 14q24.1
Pathway: Developmental Biology, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem;
Function: DNA binding; RNA polymerase II transcription cofactor activity; transcription coactivator activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.