Recombinant Human MED6 protein, T7-tagged
| Cat.No. : | MED6-131H | 
| Product Overview : | Recombinant human MED6 ( 157aa, Isoform-II ) fused with T7 Tag at N-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | T7 | 
| Protein Length : | 157 a.a. | 
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGEFMAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSA FDEAMSYCRYHPSKGYWWHFKDHEEQGK | 
| Purity : | >90% by SDS-PAGE | 
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. | 
| Gene Name | MED6 mediator complex subunit 6 [ Homo sapiens ] | 
| Official Symbol | MED6 | 
| Synonyms | MED6; mediator complex subunit 6; mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 6; NY REN 28; ARC33; hMed6; renal carcinoma antigen NY-REN-28; activator-recruited cofactor 33 kDa component; mediator of RNA polymerase II transcription, subunit 6 homolog; NY-REN-28; | 
| Gene ID | 10001 | 
| mRNA Refseq | NM_005466 | 
| Protein Refseq | NP_005457 | 
| MIM | 602984 | 
| UniProt ID | O75586 | 
| Chromosome Location | 14q24.1 | 
| Pathway | Developmental Biology, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; | 
| Function | DNA binding; RNA polymerase II transcription cofactor activity; transcription coactivator activity; transcription factor binding; | 
| ◆ Recombinant Proteins | ||
| MED6-3945C | Recombinant Chicken MED6 | +Inquiry | 
| MED6-5461M | Recombinant Mouse MED6 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MED6-6251HF | Recombinant Full Length Human MED6 Protein, GST-tagged | +Inquiry | 
| MED6-4466H | Recombinant Human MED6 Protein, GST-tagged | +Inquiry | 
| MED6-316Z | Recombinant Zebrafish MED6 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MED6-4380HCL | Recombinant Human MED6 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED6 Products
Required fields are marked with *
My Review for All MED6 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            