Recombinant Human MED6 protein, T7-tagged
Cat.No. : | MED6-131H |
Product Overview : | Recombinant human MED6 ( 157aa, Isoform-II ) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 157 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSA FDEAMSYCRYHPSKGYWWHFKDHEEQGK |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MED6 mediator complex subunit 6 [ Homo sapiens ] |
Official Symbol | MED6 |
Synonyms | MED6; mediator complex subunit 6; mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 6; NY REN 28; ARC33; hMed6; renal carcinoma antigen NY-REN-28; activator-recruited cofactor 33 kDa component; mediator of RNA polymerase II transcription, subunit 6 homolog; NY-REN-28; |
Gene ID | 10001 |
mRNA Refseq | NM_005466 |
Protein Refseq | NP_005457 |
MIM | 602984 |
UniProt ID | O75586 |
Chromosome Location | 14q24.1 |
Pathway | Developmental Biology, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; |
Function | DNA binding; RNA polymerase II transcription cofactor activity; transcription coactivator activity; transcription factor binding; |
◆ Recombinant Proteins | ||
MED6-841H | Recombinant Human Mediator Complex Subunit 6, T7-tagged | +Inquiry |
MED6-131H | Recombinant Human MED6 protein, T7-tagged | +Inquiry |
MED6-6744H | Recombinant Human MED6 protein, His-tagged | +Inquiry |
MED6-9705M | Recombinant Mouse MED6 Protein | +Inquiry |
MED6-316Z | Recombinant Zebrafish MED6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED6-4380HCL | Recombinant Human MED6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED6 Products
Required fields are marked with *
My Review for All MED6 Products
Required fields are marked with *