Recombinant Human MED6 protein, T7-tagged

• Cat.No.: MED6-131H
• Product Overview: Recombinant human MED6 ( 157aa, Isoform-II ) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 157 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSA FDEAMSYCRYHPSKGYWWHFKDHEEQGK
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: MED6 mediator complex subunit 6 [ Homo sapiens ]
• Official Symbol: MED6
• Synonyms: MED6; mediator complex subunit 6; mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 6; NY REN 28; ARC33; hMed6; renal carcinoma antigen NY-REN-28; activator-recruited cofactor 33 kDa component; mediator of RNA polymerase II transcription, subunit 6 homolog; NY-REN-28
• Gene ID: 10001
• mRNA Refseq: NM_005466
• Protein Refseq: NP_005457
• MIM: 602984
• UniProt ID: O75586
• Chromosome Location: 14q24.1
• Pathway: Developmental Biology, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem
• Function: DNA binding; RNA polymerase II transcription cofactor activity; transcription coactivator activity; transcription factor binding