Recombinant Human MEFV Protein, GST-tagged

• Cat.No.: MEFV-4454H
• Product Overview: Human MEFV partial ORF ( NP_000234, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEFV Mediterranean fever [ Homo sapiens ]
• Official Symbol: MEFV
• Synonyms: MEFV; Mediterranean fever; MEF; pyrin; FMF; TRIM20; marenostrin; MGC126560; MGC126586
• Gene ID: 4210
• mRNA Refseq: NM_000243
• Protein Refseq: NP_000234
• MIM: 608107
• UniProt ID: O15553