Recombinant Human MEMO1 Protein, GST-tagged
Cat.No. : | MEMO1-4446H |
Product Overview : | Human MEMO1 full-length ORF ( NP_057039.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MEMO1 (Mediator Of Cell Motility 1) is a Protein Coding gene. Among its related pathways are Signaling by ERBB2 and Signaling by GPCR. |
Molecular Mass : | 60.1 kDa |
AA Sequence : | MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MEMO1 mediator of cell motility 1 [ Homo sapiens ] |
Official Symbol | MEMO1 |
Synonyms | MEMO; C2orf4; CGI-27; NS5ATP7 |
Gene ID | 51072 |
mRNA Refseq | NM_015955 |
Protein Refseq | NP_057039 |
MIM | 611786 |
UniProt ID | Q9Y316 |
◆ Recombinant Proteins | ||
MEMO1-9726M | Recombinant Mouse MEMO1 Protein | +Inquiry |
MEMO1-6131HF | Recombinant Full Length Human MEMO1 Protein, GST-tagged | +Inquiry |
MEMO1-432C | Recombinant Cynomolgus Monkey MEMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEMO1-301618H | Recombinant Human MEMO1 protein, GST-tagged | +Inquiry |
MEMO1-686C | Recombinant Cynomolgus MEMO1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEMO1-4367HCL | Recombinant Human MEMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEMO1 Products
Required fields are marked with *
My Review for All MEMO1 Products
Required fields are marked with *
0
Inquiry Basket