Recombinant Human MEMO1 Protein, GST-tagged

Cat.No. : MEMO1-4446H
Product Overview : Human MEMO1 full-length ORF ( NP_057039.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MEMO1 (Mediator Of Cell Motility 1) is a Protein Coding gene. Among its related pathways are Signaling by ERBB2 and Signaling by GPCR.
Molecular Mass : 60.1 kDa
AA Sequence : MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MEMO1 mediator of cell motility 1 [ Homo sapiens ]
Official Symbol MEMO1
Synonyms MEMO; C2orf4; CGI-27; NS5ATP7
Gene ID 51072
mRNA Refseq NM_015955
Protein Refseq NP_057039
MIM 611786
UniProt ID Q9Y316

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEMO1 Products

Required fields are marked with *

My Review for All MEMO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon