Recombinant Human MEMO1 Protein, GST-tagged
| Cat.No. : | MEMO1-4446H |
| Product Overview : | Human MEMO1 full-length ORF ( NP_057039.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MEMO1 (Mediator Of Cell Motility 1) is a Protein Coding gene. Among its related pathways are Signaling by ERBB2 and Signaling by GPCR. |
| Molecular Mass : | 60.1 kDa |
| AA Sequence : | MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MEMO1 mediator of cell motility 1 [ Homo sapiens ] |
| Official Symbol | MEMO1 |
| Synonyms | MEMO; C2orf4; CGI-27; NS5ATP7 |
| Gene ID | 51072 |
| mRNA Refseq | NM_015955 |
| Protein Refseq | NP_057039 |
| MIM | 611786 |
| UniProt ID | Q9Y316 |
| ◆ Recombinant Proteins | ||
| MEMO1-1085H | Recombinant Human MEMO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MEMO1-4134C | Recombinant Chicken MEMO1 | +Inquiry |
| MEMO1-4446H | Recombinant Human MEMO1 Protein, GST-tagged | +Inquiry |
| MEMO1-6131HF | Recombinant Full Length Human MEMO1 Protein, GST-tagged | +Inquiry |
| MEMO1-432C | Recombinant Cynomolgus Monkey MEMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEMO1-4367HCL | Recombinant Human MEMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEMO1 Products
Required fields are marked with *
My Review for All MEMO1 Products
Required fields are marked with *
