Recombinant Human MEOX1

Cat.No. : MEOX1-29355TH
Product Overview : Recombinant fragment of Human MOX1 with N-terminal proprietary tag. Predicted MW 35.79KDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 88 amino acids
Description : This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight : 35.790kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Sequence Similarities : Contains 1 homeobox DNA-binding domain.
Gene Name MEOX1 mesenchyme homeobox 1 [ Homo sapiens ]
Official Symbol MEOX1
Synonyms MEOX1; mesenchyme homeobox 1; mesenchyme homeo box 1; homeobox protein MOX-1; MOX1;
Gene ID 4222
mRNA Refseq NM_001040002
Protein Refseq NP_001035091
MIM 600147
Uniprot ID P50221
Chromosome Location 17q21.31
Function DNA binding; chromatin binding; molecular_function; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEOX1 Products

Required fields are marked with *

My Review for All MEOX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon