Recombinant Human MEOX1
Cat.No. : | MEOX1-29355TH |
Product Overview : | Recombinant fragment of Human MOX1 with N-terminal proprietary tag. Predicted MW 35.79KDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 88 amino acids |
Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Weight : | 35.790kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS |
Sequence Similarities : | Contains 1 homeobox DNA-binding domain. |
Gene Name | MEOX1 mesenchyme homeobox 1 [ Homo sapiens ] |
Official Symbol | MEOX1 |
Synonyms | MEOX1; mesenchyme homeobox 1; mesenchyme homeo box 1; homeobox protein MOX-1; MOX1; |
Gene ID | 4222 |
mRNA Refseq | NM_001040002 |
Protein Refseq | NP_001035091 |
MIM | 600147 |
Uniprot ID | P50221 |
Chromosome Location | 17q21.31 |
Function | DNA binding; chromatin binding; molecular_function; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MEOX1-4443H | Recombinant Human MEOX1 Protein, GST-tagged | +Inquiry |
MEOX1-9728M | Recombinant Mouse MEOX1 Protein | +Inquiry |
MEOX1-6134HF | Recombinant Full Length Human MEOX1 Protein, GST-tagged | +Inquiry |
MEOX1-6329C | Recombinant Chicken MEOX1 | +Inquiry |
Meox1-4033M | Recombinant Mouse Meox1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEOX1-4366HCL | Recombinant Human MEOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEOX1 Products
Required fields are marked with *
My Review for All MEOX1 Products
Required fields are marked with *