Recombinant Human MEOX1

• Cat.No.: MEOX1-29355TH
• Product Overview: Recombinant fragment of Human MOX1 with N-terminal proprietary tag. Predicted MW 35.79KDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 88 amino acids
• Description: This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Weight: 35.790kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
• Sequence Similarities: Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: MEOX1 mesenchyme homeobox 1 [ Homo sapiens ]
• Official Symbol: MEOX1
• Synonyms: MEOX1; mesenchyme homeobox 1; mesenchyme homeo box 1; homeobox protein MOX-1; MOX1
• Gene ID: 4222
• mRNA Refseq: NM_001040002
• Protein Refseq: NP_001035091
• MIM: 600147
• Uniprot ID: P50221
• Chromosome Location: 17q21.31
• Function: DNA binding; chromatin binding; molecular_function; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity