Recombinant Human MEOX1 Protein (1-254 aa), GST-tagged
Cat.No. : | MEOX1-2137H |
Product Overview : | Recombinant Human MEOX1 Protein (1-254 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-254 aa |
Description : | Mesodermal transcription factor that plays a key role in somitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints. Binds specifically to the promoter of target genes and regulates their expression. Activates expression of NKX3-2 in the sclerotome. Activates expression of CDKN1A and CDKN2A in endothelial cells, acting as a regulator of vascular cell proliferation. While it activates CDKN1A in a DNA-dependent manner, it activates CDKN2A in a DNA-independent manner. Required for hematopoietic stem cell (HSCs) induction via its role in somitogenesis: specification of HSCs occurs via the deployment of a specific endothelial precursor population, which arises within a sub-compartment of the somite named endotome. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 55.0 kDa |
AA Sequence : | MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | MEOX1 mesenchyme homeobox 1 [ Homo sapiens ] |
Official Symbol | MEOX1 |
Synonyms | MEOX1; mesenchyme homeobox 1; mesenchyme homeo box 1; MOX1; |
Gene ID | 4222 |
mRNA Refseq | NM_001040002 |
Protein Refseq | NP_001035091 |
MIM | 600147 |
UniProt ID | P50221 |
◆ Recombinant Proteins | ||
MEOX1-6329C | Recombinant Chicken MEOX1 | +Inquiry |
MEOX1-6134HF | Recombinant Full Length Human MEOX1 Protein, GST-tagged | +Inquiry |
Meox1-4033M | Recombinant Mouse Meox1 Protein, Myc/DDK-tagged | +Inquiry |
MEOX1-2137H | Recombinant Human MEOX1 Protein (1-254 aa), GST-tagged | +Inquiry |
MEOX1-937H | Recombinant Human MEOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEOX1-4366HCL | Recombinant Human MEOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEOX1 Products
Required fields are marked with *
My Review for All MEOX1 Products
Required fields are marked with *
0
Inquiry Basket