Recombinant Human MESDC2 protein, GST-tagged
Cat.No. : | MESDC2-35H |
Product Overview : | Recombinant Human MESDC2 protein(1-234 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-234 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL |
Gene Name | MESDC2 mesoderm development candidate 2 [ Homo sapiens ] |
Official Symbol | MESDC2 |
Synonyms | MESDC2; mesoderm development candidate 2; LDLR chaperone MESD; BOCA; KIAA0081; MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61; |
Gene ID | 23184 |
mRNA Refseq | NM_015154 |
Protein Refseq | NP_055969 |
MIM | 607783 |
UniProt ID | Q14696 |
◆ Recombinant Proteins | ||
MESDC2-263H | Recombinant Human MESDC2 Protein, His-tagged | +Inquiry |
Mesdc2-199M | Recombinant Mouse Mesdc2 protein, His-tagged | +Inquiry |
MESDC2-35H | Recombinant Human MESDC2 protein, GST-tagged | +Inquiry |
MESDC2-5169Z | Recombinant Zebrafish MESDC2 | +Inquiry |
MESDC2-9736M | Recombinant Mouse MESDC2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MESDC2-2398HCL | Recombinant Human MESDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MESDC2 Products
Required fields are marked with *
My Review for All MESDC2 Products
Required fields are marked with *
0
Inquiry Basket