Recombinant Human METAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | METAP1-3777H |
| Product Overview : | METAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055958) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | METAP1 (Methionyl Aminopeptidase 1) is a Protein Coding gene. Diseases associated with METAP1 include Microsporidiosis. Among its related pathways are Signaling by GPCR and Metabolism of fat-soluble vitamins. Gene Ontology (GO) annotations related to this gene include hydrolase activity and metalloexopeptidase activity. An important paralog of this gene is METAP1D. |
| Molecular Mass : | 30.37 kDa |
| AA Sequence : | MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | METAP1 methionyl aminopeptidase 1 [ Homo sapiens (human) ] |
| Official Symbol | METAP1 |
| Synonyms | METAP1; methionyl aminopeptidase 1; methionine aminopeptidase 1; KIAA0094; MAP1A; MetAP1A; Peptidase M; MAP 1; metAP 1; peptidase M 1; DKFZp781C0419; |
| Gene ID | 23173 |
| mRNA Refseq | NM_015143 |
| Protein Refseq | NP_055958 |
| MIM | 610151 |
| UniProt ID | P53582 |
| ◆ Recombinant Proteins | ||
| NUDT16-152H | Recombinant Human NUDT16 Protein, His-tagged | +Inquiry |
| METAP1-3777H | Recombinant Human METAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| METAP1-15849H | Recombinant Human METAP1, His-tagged | +Inquiry |
| METAP1-5484M | Recombinant Mouse METAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUDT16-237H | Recombinant Human NUDT16 protein, T7/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METAP1-2887HCL | Recombinant Human METAP1 cell lysate | +Inquiry |
| NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METAP1 Products
Required fields are marked with *
My Review for All METAP1 Products
Required fields are marked with *
