Recombinant Human METTL14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | METTL14-6626H |
Product Overview : | METTL14 MS Standard C13 and N15-labeled recombinant protein (NP_066012) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | METTL14 (Methyltransferase Like 14) is a Protein Coding gene. Diseases associated with METTL14 include Miyoshi Muscular Dystrophy 3 and Periosteal Chondrosarcoma. Among its related pathways are Chromatin Regulation / Acetylation and Gene Expression. Gene Ontology (GO) annotations related to this gene include RNA binding and mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity. |
Molecular Mass : | 52.2 kDa |
AA Sequence : | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | METTL14 methyltransferase like 14 [ Homo sapiens (human) ] |
Official Symbol | METTL14 |
Synonyms | METTL14; methyltransferase like 14; hMETTL14; N6-adenosine-methyltransferase non-catalytic subunit; N6-adenosine-methyltransferase subunit METTL14; methyltransferase-like protein 14; EC 2.1.1.62 |
Gene ID | 57721 |
mRNA Refseq | NM_020961 |
Protein Refseq | NP_066012 |
MIM | 616504 |
UniProt ID | Q9HCE5 |
◆ Recombinant Proteins | ||
METTL14-5491M | Recombinant Mouse METTL14 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL14-1399H | Recombinant Human METTL14 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL14-2820C | Recombinant Chicken METTL14 | +Inquiry |
METTL14-925HFL | Recombinant Full Length Human METTL14 Protein, C-Flag-tagged | +Inquiry |
METTL14-35H | Recombinant Human METTL14 Protein (Full Length), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL14-4358HCL | Recombinant Human METTL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL14 Products
Required fields are marked with *
My Review for All METTL14 Products
Required fields are marked with *
0
Inquiry Basket