Recombinant Human METTL22 Protein, GST-tagged
Cat.No. : | METTL22-4404H |
Product Overview : | Human METTL22 full-length ORF ( AAH01908.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the non-histone lysine methyltransferases. It interacts with its substrate, Kin17, which is involved in DNA repair and replication and mRNA processing. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHRDVHTKEPPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIGVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL22 methyltransferase like 22 [ Homo sapiens ] |
Official Symbol | METTL22 |
Synonyms | C16orf68; METTL22; methyltransferase like 22 |
Gene ID | 79091 |
mRNA Refseq | NM_024109 |
Protein Refseq | NP_077014 |
UniProt ID | Q9BUU2 |
◆ Recombinant Proteins | ||
METTL22-7735Z | Recombinant Zebrafish METTL22 | +Inquiry |
METTL22-4404H | Recombinant Human METTL22 Protein, GST-tagged | +Inquiry |
METTL22-2746R | Recombinant Rhesus monkey METTL22 Protein, His-tagged | +Inquiry |
METTL22-6169HF | Recombinant Full Length Human METTL22 Protein, GST-tagged | +Inquiry |
METTL22-9759M | Recombinant Mouse METTL22 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL22-83HCL | Recombinant Human METTL22 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL22 Products
Required fields are marked with *
My Review for All METTL22 Products
Required fields are marked with *
0
Inquiry Basket