Recombinant Human METTL25 Protein, GST-tagged
Cat.No. : | METTL25-495H |
Product Overview : | Human C12orf26 full-length ORF ( NP_115606.1, 1 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 94.6 kDa |
AA Sequence : | MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLVEAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVKNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKKLGLDESKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALKKQQ |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL25 methyltransferase like 25 [ Homo sapiens ] |
Official Symbol | METTL25 |
Synonyms | C12orf26 |
Gene ID | 84190 |
mRNA Refseq | NM_032230.2 |
Protein Refseq | NP_115606.2 |
UniProt ID | Q8N6Q8 |
◆ Recombinant Proteins | ||
METTL25-2021HF | Recombinant Full Length Human METTL25 Protein, GST-tagged | +Inquiry |
METTL25-7574H | Recombinant Human METTL25 protein, His&Myc-tagged | +Inquiry |
METTL25-495H | Recombinant Human METTL25 Protein, GST-tagged | +Inquiry |
METTL25-4117Z | Recombinant Zebrafish METTL25 | +Inquiry |
METTL25-2627H | Recombinant Human METTL25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL25-8326HCL | Recombinant Human C12orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL25 Products
Required fields are marked with *
My Review for All METTL25 Products
Required fields are marked with *
0
Inquiry Basket