Recombinant Human METTL26 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: METTL26-5344H
• Product Overview: C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: METTL26 (Methyltransferase Like 26) is a Protein Coding gene.
• Molecular Mass: 12 kDa
• AA Sequence: MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: METTL26 methyltransferase like 26 [ Homo sapiens (human) ]
• Official Symbol: METTL26
• Synonyms: METTL26; methyltransferase like 26; JFP2; C16orf13; methyltransferase-like 26; UPF0585 protein C16orf13
• Gene ID: 84326
• mRNA Refseq: NM_001040161
• Protein Refseq: NP_001035251
• UniProt ID: Q96S19