Recombinant Human METTL26 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | METTL26-5344H |
| Product Overview : | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | METTL26 (Methyltransferase Like 26) is a Protein Coding gene. |
| Molecular Mass : | 12 kDa |
| AA Sequence : | MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | METTL26 methyltransferase like 26 [ Homo sapiens (human) ] |
| Official Symbol | METTL26 |
| Synonyms | METTL26; methyltransferase like 26; JFP2; C16orf13; methyltransferase-like 26; UPF0585 protein C16orf13 |
| Gene ID | 84326 |
| mRNA Refseq | NM_001040161 |
| Protein Refseq | NP_001035251 |
| UniProt ID | Q96S19 |
| ◆ Recombinant Proteins | ||
| METTL26-942H | Recombinant Human METTL26 Protein, MYC/DDK-tagged | +Inquiry |
| Mettl26-4046M | Recombinant Mouse Mettl26 Protein, Myc/DDK-tagged | +Inquiry |
| METTL26-5344H | Recombinant Human METTL26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL26 Products
Required fields are marked with *
My Review for All METTL26 Products
Required fields are marked with *
