Recombinant Human METTL2B Protein, GST-tagged

Cat.No. : METTL2B-4406H
Product Overview : Human METTL2 partial ORF ( NP_060866.1, 41 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Molecular Mass : 33.22 kDa
AA Sequence : SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL2B methyltransferase like 2B [ Homo sapiens ]
Official Symbol METTL2B
Synonyms METTL2B; methyltransferase like 2B; methyltransferase like 2 , METTL2; methyltransferase-like protein 2B; FLJ11350; METL; METTL2; METTL2A; PSENIP1; FLJ12760;
Gene ID 55798
mRNA Refseq NM_018396
Protein Refseq NP_060866
MIM 607846
UniProt ID Q6P1Q9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL2B Products

Required fields are marked with *

My Review for All METTL2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon