Recombinant Human METTL2B Protein, GST-tagged
| Cat.No. : | METTL2B-4406H |
| Product Overview : | Human METTL2 partial ORF ( NP_060866.1, 41 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq |
| Molecular Mass : | 33.22 kDa |
| AA Sequence : | SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | METTL2B methyltransferase like 2B [ Homo sapiens ] |
| Official Symbol | METTL2B |
| Synonyms | METTL2B; methyltransferase like 2B; methyltransferase like 2 , METTL2; methyltransferase-like protein 2B; FLJ11350; METL; METTL2; METTL2A; PSENIP1; FLJ12760; |
| Gene ID | 55798 |
| mRNA Refseq | NM_018396 |
| Protein Refseq | NP_060866 |
| MIM | 607846 |
| UniProt ID | Q6P1Q9 |
| ◆ Recombinant Proteins | ||
| METTL2B-2760H | Recombinant Human METTL2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| METTL2B-835H | Recombinant Human METTL2B, GST-tagged | +Inquiry |
| METTL2B-4406H | Recombinant Human METTL2B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL2B-1081HCL | Recombinant Human METTL2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL2B Products
Required fields are marked with *
My Review for All METTL2B Products
Required fields are marked with *




