Recombinant Human METTL4 protein, His&Myc-tagged
Cat.No. : | METTL4-6322H |
Product Overview : | Recombinant Human METTL4 protein(Q8N3J2)(1-472aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-472a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIAVESGS |
Gene Name | METTL4 methyltransferase like 4 [ Homo sapiens ] |
Official Symbol | METTL4 |
Synonyms | METTL4; methyltransferase like 4; methyltransferase-like protein 4; FLJ23017; HsT661; MGC117235; |
Gene ID | 64863 |
mRNA Refseq | NM_022840 |
Protein Refseq | NP_073751 |
UniProt ID | Q8N3J2 |
◆ Recombinant Proteins | ||
METTL4-837H | Recombinant Human METTL4, His-tagged | +Inquiry |
METTL4-977HFL | Recombinant Full Length Human METTL4 Protein, C-Flag-tagged | +Inquiry |
METTL4-6322H | Recombinant Human METTL4 protein, His&Myc-tagged | +Inquiry |
METTL4-6171HF | Recombinant Full Length Human METTL4 Protein, GST-tagged | +Inquiry |
METTL4-1193H | Recombinant Human METTL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL4 Products
Required fields are marked with *
My Review for All METTL4 Products
Required fields are marked with *
0
Inquiry Basket