Recombinant Human METTL6 Protein, GST-tagged
Cat.No. : | METTL6-4400H |
Product Overview : | Human METTL6 full-length ORF ( AAH22400.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | METTL6 (Methyltransferase Like 6) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity. An important paralog of this gene is METTL2B. |
Molecular Mass : | 56.5 kDa |
AA Sequence : | MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL6 methyltransferase like 6 [ Homo sapiens ] |
Official Symbol | METTL6 |
Synonyms | METTL6; methyltransferase like 6; methyltransferase-like protein 6; MGC24132; |
Gene ID | 131965 |
mRNA Refseq | NM_152396 |
Protein Refseq | NP_689609 |
UniProt ID | Q8TCB7 |
◆ Recombinant Proteins | ||
METTL6-3981H | Recombinant Human METTL6 protein, His-tagged | +Inquiry |
METTL6-10547Z | Recombinant Zebrafish METTL6 | +Inquiry |
METTL6-3317R | Recombinant Rat METTL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL6-6175HF | Recombinant Full Length Human METTL6 Protein, GST-tagged | +Inquiry |
METTL6-9764M | Recombinant Mouse METTL6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL6-1084HCL | Recombinant Human METTL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL6 Products
Required fields are marked with *
My Review for All METTL6 Products
Required fields are marked with *
0
Inquiry Basket