Recombinant Human METTL9 protein, GST-tagged
Cat.No. : | METTL9-3621H |
Product Overview : | Recombinant Human METTL9 protein(36-318 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 36-318 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | METTL9 methyltransferase like 9 [ Homo sapiens (human) ] |
Official Symbol | METTL9 |
Synonyms | DREV; PAP1; DREV1; CGI-81; hMETTL9 |
Gene ID | 51108 |
mRNA Refseq | NM_001077180.3 |
Protein Refseq | NP_001070648.1 |
MIM | 609388 |
UniProt ID | Q9H1A3 |
◆ Recombinant Proteins | ||
METTL9-4396H | Recombinant Human METTL9 Protein, GST-tagged | +Inquiry |
METTL9-215H | Recombinant Human METTL9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL9-5506M | Recombinant Mouse METTL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL9-1322C | Recombinant Chicken METTL9 | +Inquiry |
METTL9-3621H | Recombinant Human METTL9 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL9-4354HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
METTL9-4355HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL9 Products
Required fields are marked with *
My Review for All METTL9 Products
Required fields are marked with *