Recombinant Full Length Human METTL9 Protein, GST-tagged

Cat.No. : METTL9-6183HF
Product Overview : Human METTL9 full-length ORF (BAC11356.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 317 amino acids
Description : METTL9 (Methyltransferase Like 9) is a Protein Coding gene. Diseases associated with METTL9 include Inflammatory Bowel Disease 1. GO annotations related to this gene include methyltransferase activity.
Molecular Mass : 62.8 kDa
AA Sequence : MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL9 methyltransferase like 9 [ Homo sapiens (human) ]
Official Symbol METTL9
Synonyms METTL9; methyltransferase like 9; DREV; PAP1; DREV1; CGI-81; methyltransferase-like protein 9; CTB-31N19.3; DORA reverse strand protein 1; p53 activated protein 1
Gene ID 51108
mRNA Refseq NM_001077180
Protein Refseq NP_001070648
MIM 609388
UniProt ID Q9H1A3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL9 Products

Required fields are marked with *

My Review for All METTL9 Products

Required fields are marked with *

0
cart-icon