Recombinant Full Length Human METTL9 Protein, GST-tagged
| Cat.No. : | METTL9-6183HF |
| Product Overview : | Human METTL9 full-length ORF (BAC11356.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 317 amino acids |
| Description : | METTL9 (Methyltransferase Like 9) is a Protein Coding gene. Diseases associated with METTL9 include Inflammatory Bowel Disease 1. GO annotations related to this gene include methyltransferase activity. |
| Molecular Mass : | 62.8 kDa |
| AA Sequence : | MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | METTL9 methyltransferase like 9 [ Homo sapiens (human) ] |
| Official Symbol | METTL9 |
| Synonyms | METTL9; methyltransferase like 9; DREV; PAP1; DREV1; CGI-81; methyltransferase-like protein 9; CTB-31N19.3; DORA reverse strand protein 1; p53 activated protein 1 |
| Gene ID | 51108 |
| mRNA Refseq | NM_001077180 |
| Protein Refseq | NP_001070648 |
| MIM | 609388 |
| UniProt ID | Q9H1A3 |
| ◆ Recombinant Proteins | ||
| METTL9-4697Z | Recombinant Zebrafish METTL9 | +Inquiry |
| METTL9-5506M | Recombinant Mouse METTL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| METTL9-6183HF | Recombinant Full Length Human METTL9 Protein, GST-tagged | +Inquiry |
| METTL9-4396H | Recombinant Human METTL9 Protein, GST-tagged | +Inquiry |
| METTL9-215H | Recombinant Human METTL9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL9-4355HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
| METTL9-4354HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL9 Products
Required fields are marked with *
My Review for All METTL9 Products
Required fields are marked with *
