Recombinant Human MFAP3, His-tagged
Cat.No. : | MFAP3-140H |
Product Overview : | Recombinant Human Microfibril-Associated Glycoprotein 3/MFAP3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala19-Met147) of Human MFAP3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-147 a.a. |
AA Sequence : | AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDV HWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMV DHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MFAP3 microfibrillar-associated protein 3 [ Homo sapiens ] |
Official Symbol | MFAP3 |
Synonyms | MFAP3; microfibrillar-associated protein 3; microfibril-associated glycoprotein 3; DKFZp586F0219; |
Gene ID | 4238 |
mRNA Refseq | NM_001135037 |
Protein Refseq | NP_001128509 |
MIM | 600491 |
UniProt ID | P55082 |
Chromosome Location | 5q32-q33.2 |
◆ Recombinant Proteins | ||
MFAP3-6189HF | Recombinant Full Length Human MFAP3 Protein, GST-tagged | +Inquiry |
MFAP3-3319R | Recombinant Rat MFAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFAP3-4391H | Recombinant Human MFAP3 Protein, GST-tagged | +Inquiry |
MFAP3-2436H | Recombinant Human MFAP3 Protein, His-tagged | +Inquiry |
RFL26078HF | Recombinant Full Length Human Microfibril-Associated Glycoprotein 3(Mfap3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP3-4350HCL | Recombinant Human MFAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP3 Products
Required fields are marked with *
My Review for All MFAP3 Products
Required fields are marked with *