Recombinant Human MFAP5 Full Length protein, His tagged

• Cat.No.: MFAP5-8554H
• Product Overview: Recombinant Human MFAP5 protein(Ile22-Leu173), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 22-173 aa
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The recombinant human MFAP5 comprises 163 amino acids and has a predicted molecular mass of 18.7 kDa. The apparent molecular mass of the protein is approximately 54 and 29 kDa in SDS-PAGE under reducing conditions.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 80% as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLAHHHHHHHHHH

Gene Information

• Gene Name: MFAP5 microfibrillar associated protein 5 [ Homo sapiens ]
• Official Symbol: MFAP5
• Synonyms: MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2
• Gene ID: 8076
• mRNA Refseq: NM_003480
• Protein Refseq: NP_003471
• MIM: 601103
• UniProt ID: Q13361