Recombinant Human MFAP5 protein, His-SUMO-tagged
Cat.No. : | MFAP5-4437H |
Product Overview : | Recombinant Human MFAP5 protein(Q13361)(22-173aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-173 aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.3 kDa |
AA Sequence : | IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MFAP5 microfibrillar associated protein 5 [ Homo sapiens ] |
Official Symbol | MFAP5 |
Synonyms | MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2; |
Gene ID | 8076 |
mRNA Refseq | NM_003480 |
Protein Refseq | NP_003471 |
MIM | 601103 |
UniProt ID | Q13361 |
◆ Recombinant Proteins | ||
MFAP5-290H | Recombinant Human MFAP5 Protein, His-tagged | +Inquiry |
MFAP5-4387H | Recombinant Human MFAP5 Protein, GST-tagged | +Inquiry |
MFAP5-1927H | Recombinant Human MFAP5 protein, Fc-tagged | +Inquiry |
MFAP5-8554H | Recombinant Human MFAP5 Full Length protein, His tagged | +Inquiry |
Mfap5-292R | Recombinant Rat Mfap5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *