Recombinant Human MGA protein, GST-tagged
Cat.No. : | MGA-301545H |
Product Overview : | Recombinant Human MGA (1985-2170 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser1985-Gln2170 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SLEDRGDHLDEECLPEEGCATVKPSEHSCITGSHTDQDYKDVNEEYGARNRKSSKEKVAVLEVRTISEKASNKTVQNLSKVQHQKLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MGA MAX gene associated [ Homo sapiens ] |
Official Symbol | MGA |
Synonyms | MGA; MAX gene associated; MAX gene-associated protein; FLJ12634; KIAA0518; MAD5; MXD5; MAX dimerization protein 5; |
Gene ID | 23269 |
mRNA Refseq | NM_001080541 |
Protein Refseq | NP_001074010 |
UniProt ID | Q8IWI9 |
◆ Recombinant Proteins | ||
MGA-301545H | Recombinant Human MGA protein, GST-tagged | +Inquiry |
MGA-4140H | Recombinant Human MGA Protein (Leu2450-Val2733), N-His tagged | +Inquiry |
MGA-306H | Recombinant Human MGA Protein, His-tagged | +Inquiry |
MGA-5838H | Recombinant Human MGA protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGA Products
Required fields are marked with *
My Review for All MGA Products
Required fields are marked with *
0
Inquiry Basket