Recombinant Human MGAT1

Cat.No. : MGAT1-29206TH
Product Overview : Recombinant fragment of Human MGAT1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I is a medial-Golgi enzyme essential for the synthesis of hybrid and complex N-glycans. The protein, encoded by a single exon, shows typical features of a type II transmembrane protein. The protein is believed to be essential for normal embryogenesis. Several variants encoding the same protein have been found for this gene.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Appears to be present in all tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSWN
Sequence Similarities : Belongs to the glycosyltransferase 13 family.
Gene Name MGAT1 mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol MGAT1
Synonyms MGAT1; mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase; GLYT1, MGAT; alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase; GLCNAC TI; GNT 1;
Gene ID 4245
mRNA Refseq NM_001114617
Protein Refseq NP_001108089
MIM 160995
Uniprot ID P26572
Chromosome Location 5
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem;
Function acetylglucosaminyltransferase activity; alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGAT1 Products

Required fields are marked with *

My Review for All MGAT1 Products

Required fields are marked with *

0
cart-icon