Recombinant Human MGAT1
| Cat.No. : | MGAT1-29206TH |
| Product Overview : | Recombinant fragment of Human MGAT1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I is a medial-Golgi enzyme essential for the synthesis of hybrid and complex N-glycans. The protein, encoded by a single exon, shows typical features of a type II transmembrane protein. The protein is believed to be essential for normal embryogenesis. Several variants encoding the same protein have been found for this gene. |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Tissue specificity : | Appears to be present in all tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSWN |
| Sequence Similarities : | Belongs to the glycosyltransferase 13 family. |
| Gene Name | MGAT1 mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [ Homo sapiens ] |
| Official Symbol | MGAT1 |
| Synonyms | MGAT1; mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase; GLYT1, MGAT; alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase; GLCNAC TI; GNT 1; |
| Gene ID | 4245 |
| mRNA Refseq | NM_001114617 |
| Protein Refseq | NP_001108089 |
| MIM | 160995 |
| Uniprot ID | P26572 |
| Chromosome Location | 5 |
| Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem; |
| Function | acetylglucosaminyltransferase activity; alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups; |
| ◆ Cell & Tissue Lysates | ||
| MGAT1-4343HCL | Recombinant Human MGAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGAT1 Products
Required fields are marked with *
My Review for All MGAT1 Products
Required fields are marked with *
