Recombinant Human MGLL protein, GST-tagged
Cat.No. : | MGLL-3221H |
Product Overview : | Recombinant Human MGLL protein(Q99685)(1-303aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-303aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60.3 kDa |
AA Sequence : | MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MGLL monoglyceride lipase [ Homo sapiens ] |
Official Symbol | MGLL |
Synonyms | MGLL; monoglyceride lipase; HU K5; MGL; monoacylglycerol lipase; lysophospholipase homolog; HUK5; MAGL; HU-K5; |
Gene ID | 11343 |
mRNA Refseq | NM_001003794 |
Protein Refseq | NP_001003794 |
MIM | 609699 |
UniProt ID | Q99685 |
◆ Recombinant Proteins | ||
MGLL-730HFL | Recombinant Full Length Human MGLL Protein, C-Flag-tagged | +Inquiry |
MGLL-0324H | Recombinant Human MGLL Protein (P2-P303), His tagged | +Inquiry |
MGLL-5303H | Recombinant Human MGLL Protein, GST-tagged | +Inquiry |
MGLL-3983H | Recombinant Human MGLL Protein (Met1-Pro303), N-His tagged | +Inquiry |
MGLL18930H | Recombinant Human MGLL (1-303) (K36A L169S L176S) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *
0
Inquiry Basket