Recombinant Human MGLL protein, GST-tagged
| Cat.No. : | MGLL-3221H |
| Product Overview : | Recombinant Human MGLL protein(Q99685)(1-303aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-303aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 60.3 kDa |
| AA Sequence : | MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MGLL monoglyceride lipase [ Homo sapiens ] |
| Official Symbol | MGLL |
| Synonyms | MGLL; monoglyceride lipase; HU K5; MGL; monoacylglycerol lipase; lysophospholipase homolog; HUK5; MAGL; HU-K5; |
| Gene ID | 11343 |
| mRNA Refseq | NM_001003794 |
| Protein Refseq | NP_001003794 |
| MIM | 609699 |
| UniProt ID | Q99685 |
| ◆ Recombinant Proteins | ||
| MGLL-3673R | Recombinant Rat MGLL Protein | +Inquiry |
| MGLL-39H | Recombinant Human MGLL Protein, His-tagged | +Inquiry |
| MGLL-2105M | Recombinant Mouse MGLL Protein (1-303 aa), His-tagged | +Inquiry |
| MGLL-5540M | Recombinant Mouse MGLL Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGLL-17H | Active Recombinant Human MGLL protein, His-tagged (Bioactivity Validated) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
| MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *
