Recombinant Human MHC protein, GST-tagged
Cat.No. : | MHC-301402H |
Product Overview : | Recombinant Human MHC (72-200 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Trp72-Leu200 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | WMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | HLA-E major histocompatibility complex, class I, E [ Homo sapiens (human) ] |
Official Symbol | MHC |
Synonyms | HLA-E; QA1; HLA-6.2 |
Gene ID | 3133 |
mRNA Refseq | NM_005516 |
Protein Refseq | NP_005507 |
MIM | 143010 |
UniProt ID | P13747 |
◆ Recombinant Proteins | ||
MHC-301402H | Recombinant Human MHC protein, GST-tagged | +Inquiry |
Mhc-1343f | Recombinant fruit fly Mhc protein, His-tagged | +Inquiry |
Mhc-1858f | Recombinant fruit fly Mhc protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MHC Products
Required fields are marked with *
My Review for All MHC Products
Required fields are marked with *