Recombinant Human MIB2 Protein, GST-tagged

Cat.No. : MIB2-5317H
Product Overview : Human MIB2 partial ORF ( AAH37542, 381 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion. [provided by RefSeq, Mar 2017]
Molecular Mass : 36.74 kDa
AA Sequence : IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIB2 mindbomb E3 ubiquitin protein ligase 2 [ Homo sapiens ]
Official Symbol MIB2
Synonyms MIB2; mindbomb E3 ubiquitin protein ligase 2; mindbomb homolog 2 (Drosophila) , zinc finger, ZZ type with ankyrin repeat domain 1 , ZZANK1; E3 ubiquitin-protein ligase MIB2; FLJ39787; skeletrophin; ZZZ5; novelzin; mindbomb homolog 2; mind bomb homolog 2; novel zinc finger protein; putative NF-kappa-B-activating protein 002N; zinc finger, ZZ type with ankyrin repeat domain 1; zinc finger ZZ type with ankyrin repeat domain protein 1; ZZANK1; FLJ20648; FLJ41406;
Gene ID 142678
mRNA Refseq NM_001170686
Protein Refseq NP_001164157
MIM 611141
UniProt ID Q96AX9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIB2 Products

Required fields are marked with *

My Review for All MIB2 Products

Required fields are marked with *

0
cart-icon