Recombinant Human MIB2 Protein, GST-tagged
Cat.No. : | MIB2-5317H |
Product Overview : | Human MIB2 partial ORF ( AAH37542, 381 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIB2 mindbomb E3 ubiquitin protein ligase 2 [ Homo sapiens ] |
Official Symbol | MIB2 |
Synonyms | MIB2; mindbomb E3 ubiquitin protein ligase 2; mindbomb homolog 2 (Drosophila) , zinc finger, ZZ type with ankyrin repeat domain 1 , ZZANK1; E3 ubiquitin-protein ligase MIB2; FLJ39787; skeletrophin; ZZZ5; novelzin; mindbomb homolog 2; mind bomb homolog 2; novel zinc finger protein; putative NF-kappa-B-activating protein 002N; zinc finger, ZZ type with ankyrin repeat domain 1; zinc finger ZZ type with ankyrin repeat domain protein 1; ZZANK1; FLJ20648; FLJ41406; |
Gene ID | 142678 |
mRNA Refseq | NM_001170686 |
Protein Refseq | NP_001164157 |
MIM | 611141 |
UniProt ID | Q96AX9 |
◆ Recombinant Proteins | ||
Mib2-1886R | Recombinant Rat Mib2 protein, His & T7-tagged | +Inquiry |
Mib2-1885M | Recombinant Mouse Mib2 protein, His & T7-tagged | +Inquiry |
MIB2-1884H | Recombinant Human MIB2 protein, His & T7-tagged | +Inquiry |
MIB2-4886Z | Recombinant Zebrafish MIB2 | +Inquiry |
MIB2-1446C | Recombinant Chicken MIB2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIB2 Products
Required fields are marked with *
My Review for All MIB2 Products
Required fields are marked with *