Recombinant Human MICALL2 protein, His-tagged

Cat.No. : MICALL2-2551H
Product Overview : Recombinant Human MICALL2 protein(306-605 aa), fused to His tag, was expressed in E. coli.
Availability October 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 306-605 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : PAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MICALL2 MICAL-like 2 [ Homo sapiens ]
Official Symbol MICALL2
Synonyms MICALL2; MICAL-like 2; MICAL-like protein 2; FLJ23471; JRAB; junctional Rab13 binding protein; MGC46023; MICAL L2; junctional Rab13-binding protein; MICAL-L2; FLJ41996; FLJ44858; FLJ45410;
Gene ID 79778
mRNA Refseq NM_182924
Protein Refseq NP_891554
UniProt ID Q8IY33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MICALL2 Products

Required fields are marked with *

My Review for All MICALL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon