Recombinant Human MICALL2 protein, His-tagged
Cat.No. : | MICALL2-2551H |
Product Overview : | Recombinant Human MICALL2 protein(306-605 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 306-605 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MICALL2 MICAL-like 2 [ Homo sapiens ] |
Official Symbol | MICALL2 |
Synonyms | MICALL2; MICAL-like 2; MICAL-like protein 2; FLJ23471; JRAB; junctional Rab13 binding protein; MGC46023; MICAL L2; junctional Rab13-binding protein; MICAL-L2; FLJ41996; FLJ44858; FLJ45410; |
Gene ID | 79778 |
mRNA Refseq | NM_182924 |
Protein Refseq | NP_891554 |
UniProt ID | Q8IY33 |
◆ Recombinant Proteins | ||
MICALL2-5325H | Recombinant Human MICALL2 Protein, GST-tagged | +Inquiry |
MICALL2-5553M | Recombinant Mouse MICALL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MICALL2-2551H | Recombinant Human MICALL2 protein, His-tagged | +Inquiry |
MICALL2-9830M | Recombinant Mouse MICALL2 Protein | +Inquiry |
MICALL2-6577HF | Recombinant Full Length Human MICALL2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MICALL2 Products
Required fields are marked with *
My Review for All MICALL2 Products
Required fields are marked with *
0
Inquiry Basket