Recombinant Human MIER3 Protein, GST-tagged
Cat.No. : | MIER3-4024H |
Product Overview : | Human DKFZP781I1119 full-length ORF ( AAH41348.2, 1 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MIER3 (MIER Family Member 3) is a Protein Coding gene. GO annotations related to this gene include chromatin binding. An important paralog of this gene is MIER1. |
Molecular Mass : | 84.9 kDa |
AA Sequence : | MLVHDYDDERTLEEEEMMDEGKNFSSEIEDLEKEGTMPLEDLLAFYGYEPTIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEETQSSADGLTPSVTSHETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEKVYENEDQLLWCPDVVLESKVKEYLVETSLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQGMTAWTEEECRSFEHALMLFGKDFHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGVTDYMDRLVDETEALGGTVNASALTSNRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSFPPLGNTPRGQVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIER3 mesoderm induction early response 1, family member 3 [ Homo sapiens ] |
Official Symbol | MIER3 |
Synonyms | MIER3; mesoderm induction early response 1, family member 3; mesoderm induction early response protein 3; DKFZp686L09111; DKFZp781I1119; FLJ35954; mi-er3; DKFZp781G1119; |
Gene ID | 166968 |
mRNA Refseq | NM_152622 |
Protein Refseq | NP_689835 |
UniProt ID | Q7Z3K6 |
◆ Recombinant Proteins | ||
MIER3-4024H | Recombinant Human MIER3 Protein, GST-tagged | +Inquiry |
MIER3-4696HF | Recombinant Full Length Human MIER3 Protein, GST-tagged | +Inquiry |
MIER3-3264Z | Recombinant Zebrafish MIER3 | +Inquiry |
MIER3-881H | Recombinant Human MIER3, GST-tagged | +Inquiry |
MIER3-9839M | Recombinant Mouse MIER3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIER3-4316HCL | Recombinant Human MIER3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIER3 Products
Required fields are marked with *
My Review for All MIER3 Products
Required fields are marked with *