Recombinant Human MIER3 Protein, GST-tagged

Cat.No. : MIER3-4024H
Product Overview : Human DKFZP781I1119 full-length ORF ( AAH41348.2, 1 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MIER3 (MIER Family Member 3) is a Protein Coding gene. GO annotations related to this gene include chromatin binding. An important paralog of this gene is MIER1.
Molecular Mass : 84.9 kDa
AA Sequence : MLVHDYDDERTLEEEEMMDEGKNFSSEIEDLEKEGTMPLEDLLAFYGYEPTIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEETQSSADGLTPSVTSHETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEKVYENEDQLLWCPDVVLESKVKEYLVETSLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQGMTAWTEEECRSFEHALMLFGKDFHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGVTDYMDRLVDETEALGGTVNASALTSNRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSFPPLGNTPRGQVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIER3 mesoderm induction early response 1, family member 3 [ Homo sapiens ]
Official Symbol MIER3
Synonyms MIER3; mesoderm induction early response 1, family member 3; mesoderm induction early response protein 3; DKFZp686L09111; DKFZp781I1119; FLJ35954; mi-er3; DKFZp781G1119;
Gene ID 166968
mRNA Refseq NM_152622
Protein Refseq NP_689835
UniProt ID Q7Z3K6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIER3 Products

Required fields are marked with *

My Review for All MIER3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon