Recombinant Human MINPP1, His-tagged

Cat.No. : MINPP1-142H
Product Overview : Recombinant Human Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 produced by transfected human cellss is a secreted protein with sequence (Ser31-Leu487) of Human MINPP1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 31-487 a.a.
Description : Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 is an enzyme that removes 3-phosphate from inositol phosphate substrates. MINPP1 also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate. MINPP1 is synthesized as a 487 amino acid precursor that contains an 30 amino acid signal peptide and a 457 amino aicd mature chain. MINPP1 is widely expressed with the highest levels found in kidney, liver and placenta. It acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). MINPP1 may play a role in bone development (endochondral ossification).
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5
AA Sequence : SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPT VKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALR LASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKL MRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSF DLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQ RSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSD ELVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name MINPP1 multiple inositol-polyphosphate phosphatase 1 [ Homo sapiens ]
Official Symbol MINPP1
Synonyms MINPP1; multiple inositol-polyphosphate phosphatase 1; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; MIPP; ins(1,3,4,5)P(4) 3-phosphatase; multiple inositol polyphosphate phosphatase 2; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; HIPER1; MINPP2; DKFZp564L2016;
Gene ID 9562
mRNA Refseq NM_001178117
Protein Refseq NP_001171588
MIM 605391
UniProt ID Q9UNW1
Chromosome Location 10q23
Pathway D-myo-inositol (1,3,4)-trisphosphate biosynthesis, organism-specific biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5,6)-tetrakisphosphate biosynthesis, organism-specific biosystem; D-myo-inositol (1,4,5,6)-tetrakisphosphate biosynthesis, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Rapoport-Luebering glycolytic shunt, organism-specific biosystem;
Function acid phosphatase activity; bisphosphoglycerate 3-phosphatase activity; hydrolase activity; inositol hexakisphosphate 2-phosphatase activity; inositol-1,3,4,5,6-pentakisphosphate 3-phosphatase activity; inositol-1,4,5,6-tetrakisphosphate 6-phosphatase activity; phosphohistidine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MINPP1 Products

Required fields are marked with *

My Review for All MINPP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon