Recombinant Human MINPP1 Protein, His-tagged

Cat.No. : MINPP1-549H
Product Overview : Recombinant Human MINPP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5
Molecular Mass : 53.14kD
AA Sequence : SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDELVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name MINPP1 multiple inositol-polyphosphate phosphatase 1 [ Homo sapiens ]
Official Symbol MINPP1
Synonyms MINPP1; multiple inositol-polyphosphate phosphatase 1; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; MIPP; ins(1,3,4,5)P(4) 3-phosphatase; multiple inositol polyphosphate phosphatase 2; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; HIPER1; MINPP2; DKFZp564L2016;
Gene ID 9562
mRNA Refseq NM_001178117
Protein Refseq NP_001171588
MIM 605391
UniProt ID Q9UNW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MINPP1 Products

Required fields are marked with *

My Review for All MINPP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon