Recombinant Human MINPP1 Protein, His-tagged
Cat.No. : | MINPP1-549H |
Product Overview : | Recombinant Human MINPP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5 |
Molecular Mass : | 53.14kD |
AA Sequence : | SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDELVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | MINPP1 multiple inositol-polyphosphate phosphatase 1 [ Homo sapiens ] |
Official Symbol | MINPP1 |
Synonyms | MINPP1; multiple inositol-polyphosphate phosphatase 1; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; MIPP; ins(1,3,4,5)P(4) 3-phosphatase; multiple inositol polyphosphate phosphatase 2; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; HIPER1; MINPP2; DKFZp564L2016; |
Gene ID | 9562 |
mRNA Refseq | NM_001178117 |
Protein Refseq | NP_001171588 |
MIM | 605391 |
UniProt ID | Q9UNW1 |
◆ Recombinant Proteins | ||
MINPP1-1412H | Recombinant Human MINPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MINPP1-5344H | Recombinant Human MINPP1 Protein, GST-tagged | +Inquiry |
MINPP1-6212C | Recombinant Chicken MINPP1 | +Inquiry |
MINPP1-1456R | Recombinant Rat MINPP1 Protein (31-481 aa), His-tagged | +Inquiry |
MINPP1-9847M | Recombinant Mouse MINPP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MINPP1-4312HCL | Recombinant Human MINPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MINPP1 Products
Required fields are marked with *
My Review for All MINPP1 Products
Required fields are marked with *
0
Inquiry Basket