Recombinant Human MINPP1 Protein, His-tagged
| Cat.No. : | MINPP1-549H |
| Product Overview : | Recombinant Human MINPP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 31-487 aa |
| Description : | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway. |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5 |
| Molecular Mass : | 53.14kD |
| AA Sequence : | SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDELVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | MINPP1 multiple inositol-polyphosphate phosphatase 1 [ Homo sapiens ] |
| Official Symbol | MINPP1 |
| Synonyms | MINPP1; multiple inositol-polyphosphate phosphatase 1; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; MIPP; ins(1,3,4,5)P(4) 3-phosphatase; multiple inositol polyphosphate phosphatase 2; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; HIPER1; MINPP2; DKFZp564L2016; |
| Gene ID | 9562 |
| mRNA Refseq | NM_001178117 |
| Protein Refseq | NP_001171588 |
| MIM | 605391 |
| UniProt ID | Q9UNW1 |
| ◆ Recombinant Proteins | ||
| MINPP1-654R | Recombinant Rat MINPP1 Protein (31-481 aa), His-tagged | +Inquiry |
| MINPP1-641H | Recombinant Human MINPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MINPP1-9847M | Recombinant Mouse MINPP1 Protein | +Inquiry |
| MINPP1-1456R | Recombinant Rat MINPP1 Protein (31-481 aa), His-tagged | +Inquiry |
| MINPP1-5344H | Recombinant Human MINPP1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MINPP1-4312HCL | Recombinant Human MINPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MINPP1 Products
Required fields are marked with *
My Review for All MINPP1 Products
Required fields are marked with *
