Recombinant Human MINPP1 Protein, His-tagged

• Cat.No.: MINPP1-549H
• Product Overview: Recombinant Human MINPP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5
• Molecular Mass: 53.14kD
• AA Sequence: SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDELVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: MINPP1 multiple inositol-polyphosphate phosphatase 1 [ Homo sapiens ]
• Official Symbol: MINPP1
• Synonyms: MINPP1; multiple inositol-polyphosphate phosphatase 1; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; MIPP; ins(1,3,4,5)P(4) 3-phosphatase; multiple inositol polyphosphate phosphatase 2; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; HIPER1; MINPP2; DKFZp564L2016
• Gene ID: 9562
• mRNA Refseq: NM_001178117
• Protein Refseq: NP_001171588
• MIM: 605391
• UniProt ID: Q9UNW1