Recombinant Human MITD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MITD1-1265H
Product Overview : MITD1 MS Standard C13 and N15-labeled recombinant protein (NP_620153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Abscission, the separation of daughter cells at the end of cytokinesis, is effected by endosomal sorting complexes required for transport III (ESCRT-III). The protein encoded by this gene functions as a homodimer, with the N-termini binding to a subset of ESCRT-III subunits and the C-termini binding to membranes. The encoded protein regulates ESCRT-III activity and is required for proper cytokinesis. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 29.3 kDa
AA Sequence : MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MITD1 microtubule interacting and trafficking domain containing 1 [ Homo sapiens (human) ]
Official Symbol MITD1
Synonyms MITD1; MIT, microtubule interacting and transport, domain containing 1; MIT domain-containing protein 1; LOC129531;
Gene ID 129531
mRNA Refseq NM_138798
Protein Refseq NP_620153
UniProt ID Q8WV92

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MITD1 Products

Required fields are marked with *

My Review for All MITD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon