Recombinant Human mitogen activated protein kinase kinase kinase 5 Protein, His tagged
Cat.No. : | MAP3K5-01H |
Product Overview : | Recombinant Human MAP3K5 Protein with His tag was expressed in Baculovirus-Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 1011-1196 aa |
Description : | Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protein kinase, MAPK kinase/MEK, which in turn activates MAPK. The kinases of these signaling cascades are highly conserved, and homologs exist in yeast, Drosophila, and mammalian cells. MAPKKK5 contains 1,374 amino acids with all 11 kinase subdomains. Northern blot analysis shows that MAPKKK5 transcript is abundantly expressed in human heart and pancreas. The MAPKKK5 protein phosphorylates and activates MKK4 (aliases SERK1, MAPKK4) in vitro, and activates c-Jun N-terminal kinase (JNK)/stress-activated protein kinase (SAPK) during transient expression in COS and 293 cells; MAPKKK5 does not activate MAPK/ERK. |
Tag : | C-His |
Molecular Mass : | 22 kDa |
AA Sequence : | MKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDHHHHHHHH |
Endotoxin : | < 1 EU/μg |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | MAP3K5 mitogen-activated protein kinase kinase kinase 5 [ Homo sapiens (human) ] |
Official Symbol | MAP3K5 |
Synonyms | MAP3K5; mitogen-activated protein kinase kinase kinase 5; MEKK5; apoptosis signal regulating kinase 1; ASK1; MAPKKK5; ASK-1; MEKK 5; MEK kinase 5; MAP/ERK kinase kinase 5; MAPK/ERK kinase kinase 5; apoptosis signal-regulating kinase 1 |
Gene ID | 4217 |
mRNA Refseq | NM_005923 |
Protein Refseq | NP_005914 |
MIM | 602448 |
UniProt ID | Q99683 |
◆ Recombinant Proteins | ||
MAP3K5-26518TH | Recombinant Human MAP3K5 | +Inquiry |
MAP3K5-11H | Recombinant Human MAP3K5 protein, His-tagged | +Inquiry |
MAP3K5-361HFL | Recombinant Full Length Human MAP3K5 Protein, C-Flag-tagged | +Inquiry |
MAP3K5-01H | Recombinant Human mitogen activated protein kinase kinase kinase 5 Protein, His tagged | +Inquiry |
MAP3K5-63H | Recombinant Human MAP3K5 protein, Flag-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K5-4504HCL | Recombinant Human MAP3K5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP3K5 Products
Required fields are marked with *
My Review for All MAP3K5 Products
Required fields are marked with *
0
Inquiry Basket