Recombinant Human MKI67 protein(3120-3256aa), His-tagged
| Cat.No. : | MKI67-245H |
| Product Overview : | Recombinant Human MKI67 protein(P46013)(3120-3256aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 3120-3256aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.3kDa |
| AA Sequence : | NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Publications : |
| Gene Name | MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ] |
| Official Symbol | MKI67 |
| Synonyms | MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA |
| Gene ID | 4288 |
| mRNA Refseq | NM_001145966 |
| Protein Refseq | NP_001139438 |
| MIM | 176741 |
| UniProt ID | P46013 |
| ◆ Recombinant Proteins | ||
| Mki67-169M | Recombinant Mouse Mki67 Protein, His-tagged | +Inquiry |
| MKI67-245H | Recombinant Human MKI67 protein(3120-3256aa), His-tagged | +Inquiry |
| MKI67-3226H | Recombinant Human MKI67 protein, His-SUMO-tagged | +Inquiry |
| MKI67-8299Z | Recombinant Zebrafish MKI67 | +Inquiry |
| MKI67-8560H | Recombinant Human MKI67 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKI67 Products
Required fields are marked with *
My Review for All MKI67 Products
Required fields are marked with *
