Recombinant Human MKRN1 protein, His-tagged

Cat.No. : MKRN1-896H
Product Overview : Recombinant Human MKRN1 protein(Q9UHC7)(Lys351-Phe470), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Lys351-Phe470
Form : 0.15 M Phosphate buffered saline, pH 7.4.
Molecular Mass : 16 kDa
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLF
Gene Name MKRN1 makorin ring finger protein 1 [ Homo sapiens ]
Official Symbol MKRN1
Synonyms MKRN1; makorin ring finger protein 1; E3 ubiquitin-protein ligase makorin-1; RNF61; RING finger protein 61; FLJ21334;
Gene ID 23608
mRNA Refseq NM_001145125
Protein Refseq NP_001138597
MIM 607754
UniProt ID Q9UHC7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MKRN1 Products

Required fields are marked with *

My Review for All MKRN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon