Recombinant Human MKRN1 protein, His-tagged

• Cat.No.: MKRN1-896H
• Product Overview: Recombinant Human MKRN1 protein(Q9UHC7)(Lys351-Phe470), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Lys351-Phe470
• Form: 0.15 M Phosphate buffered saline, pH 7.4.
• Molecular Mass: 16 kDa
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLF

Gene Information

• Gene Name: MKRN1 makorin ring finger protein 1 [ Homo sapiens ]
• Official Symbol: MKRN1
• Synonyms: MKRN1; makorin ring finger protein 1; E3 ubiquitin-protein ligase makorin-1; RNF61; RING finger protein 61; FLJ21334
• Gene ID: 23608
• mRNA Refseq: NM_001145125
• Protein Refseq: NP_001138597
• MIM: 607754
• UniProt ID: Q9UHC7