Recombinant Human MLF2 Protein, GST-tagged
Cat.No. : | MLF2-5384H |
Product Overview : | Human MLF2 full-length ORF ( AAH00898, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MLF2 (Myeloid Leukemia Factor 2) is a Protein Coding gene. Diseases associated with MLF2 include Myeloid Leukemia and Leukemia. An important paralog of this gene is MLF1. |
Molecular Mass : | 53.02 kDa |
AA Sequence : | MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLF2 myeloid leukemia factor 2 [ Homo sapiens ] |
Official Symbol | MLF2 |
Synonyms | MLF2; myeloid leukemia factor 2; NTN4; myelodysplasia-myeloid leukemia factor 2; |
Gene ID | 8079 |
mRNA Refseq | NM_005439 |
Protein Refseq | NP_005430 |
MIM | 601401 |
UniProt ID | Q15773 |
◆ Recombinant Proteins | ||
MLF2-3134Z | Recombinant Zebrafish MLF2 | +Inquiry |
MLF2-6352HF | Recombinant Full Length Human MLF2 Protein, GST-tagged | +Inquiry |
MLF2-5384H | Recombinant Human MLF2 Protein, GST-tagged | +Inquiry |
MLF2-2475C | Recombinant Chicken MLF2 | +Inquiry |
MLF2-2602R | Recombinant Rhesus Macaque MLF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLF2-4296HCL | Recombinant Human MLF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLF2 Products
Required fields are marked with *
My Review for All MLF2 Products
Required fields are marked with *
0
Inquiry Basket