Recombinant Human MLF2 Protein, GST-tagged

Cat.No. : MLF2-5384H
Product Overview : Human MLF2 full-length ORF ( AAH00898, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MLF2 (Myeloid Leukemia Factor 2) is a Protein Coding gene. Diseases associated with MLF2 include Myeloid Leukemia and Leukemia. An important paralog of this gene is MLF1.
Molecular Mass : 53.02 kDa
AA Sequence : MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MLF2 myeloid leukemia factor 2 [ Homo sapiens ]
Official Symbol MLF2
Synonyms MLF2; myeloid leukemia factor 2; NTN4; myelodysplasia-myeloid leukemia factor 2;
Gene ID 8079
mRNA Refseq NM_005439
Protein Refseq NP_005430
MIM 601401
UniProt ID Q15773

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLF2 Products

Required fields are marked with *

My Review for All MLF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon