Recombinant Human MLLT10 Protein, GST-tagged
Cat.No. : | MLLT10-5391H |
Product Overview : | Human MLLT10 partial ORF ( NP_001009569, 695 a.a. - 793 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transcription factor and has been identified as a partner gene involved in several chromosomal rearrangements resulting in various leukemias. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLLT10 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10 [ Homo sapiens ] |
Official Symbol | MLLT10 |
Synonyms | MLLT10; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10; myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 10; protein AF-10; AF10; type I AF10 protein; type IV AF10 protein; type III AF10 protein; ALL1-fused gene from chromosome 10 protein; MGC75086; DKFZp686E10210; |
Gene ID | 8028 |
mRNA Refseq | NM_001195626 |
Protein Refseq | NP_001182555 |
MIM | 602409 |
UniProt ID | P55197 |
◆ Recombinant Proteins | ||
MLLT10-5584M | Recombinant Mouse MLLT10 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLLT10-9885M | Recombinant Mouse MLLT10 Protein | +Inquiry |
MLLT10-5391H | Recombinant Human MLLT10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLLT10-4293HCL | Recombinant Human MLLT10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLLT10 Products
Required fields are marked with *
My Review for All MLLT10 Products
Required fields are marked with *
0
Inquiry Basket