Recombinant Human MLST8 protein, GST-tagged

Cat.No. : MLST8-301105H
Product Overview : Recombinant Human MLST8 (1-204 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Gly326
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol MLST8
Synonyms MLST8; MTOR associated protein, LST8 homolog (S. cerevisiae); target of rapamycin complex subunit LST8; G protein beta subunit like; GbetaL; GBL; Lst8; Pop3; gable; protein GbetaL; TORC subunit LST8; mammalian lethal with SEC13 protein 8; LST8; POP3; WAT1; MGC111011;
Gene ID 64223
mRNA Refseq NM_001199173
Protein Refseq NP_001186102
MIM 612190
UniProt ID Q9BVC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLST8 Products

Required fields are marked with *

My Review for All MLST8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon