Recombinant Human MLST8 Protein, GST-tagged
Cat.No. : | MLST8-5397H |
Product Overview : | Human MLST8 full-length ORF ( NP_071767.3, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | August 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MLST8 (MTOR Associated Protein, LST8 Homolog) is a Protein Coding gene. Diseases associated with MLST8 include Benign Familial Neonatal Epilepsy and Childhood Absence Epilepsy. Among its related pathways are CD28 co-stimulation and RET signaling. |
Molecular Mass : | 62.3 kDa |
AA Sequence : | MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MLST8 |
Synonyms | MLST8; MTOR associated protein, LST8 homolog (S. cerevisiae); target of rapamycin complex subunit LST8; G protein beta subunit like; GbetaL; GBL; Lst8; Pop3; gable; protein GbetaL; TORC subunit LST8; mammalian lethal with SEC13 protein 8; LST8; POP3; WAT1; MGC111011; |
Gene ID | 64223 |
mRNA Refseq | NM_001199173 |
Protein Refseq | NP_001186102 |
MIM | 612190 |
UniProt ID | Q9BVC4 |
◆ Recombinant Proteins | ||
MLST8-2917H | Recombinant Human MTOR Associated Protein, LST8 Homolog (S. cerevisiae), T7-tagged | +Inquiry |
MLST8-1444H | Recombinant Human MLST8 protein, His & T7-tagged | +Inquiry |
MLST8-5589M | Recombinant Mouse MLST8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLST8-26546TH | Recombinant Human MLST8, T7 -tagged | +Inquiry |
MLST8-5091H | Recombinant Human MLST8 Protein (Tyr68-Trp247), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLST8-4288HCL | Recombinant Human MLST8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLST8 Products
Required fields are marked with *
My Review for All MLST8 Products
Required fields are marked with *