Recombinant Human MLST8 Protein, GST-tagged

Cat.No. : MLST8-5397H
Product Overview : Human MLST8 full-length ORF ( NP_071767.3, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.
Availability September 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MLST8 (MTOR Associated Protein, LST8 Homolog) is a Protein Coding gene. Diseases associated with MLST8 include Benign Familial Neonatal Epilepsy and Childhood Absence Epilepsy. Among its related pathways are CD28 co-stimulation and RET signaling.
Molecular Mass : 62.3 kDa
AA Sequence : MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol MLST8
Synonyms MLST8; MTOR associated protein, LST8 homolog (S. cerevisiae); target of rapamycin complex subunit LST8; G protein beta subunit like; GbetaL; GBL; Lst8; Pop3; gable; protein GbetaL; TORC subunit LST8; mammalian lethal with SEC13 protein 8; LST8; POP3; WAT1; MGC111011;
Gene ID 64223
mRNA Refseq NM_001199173
Protein Refseq NP_001186102
MIM 612190
UniProt ID Q9BVC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLST8 Products

Required fields are marked with *

My Review for All MLST8 Products

Required fields are marked with *

0
cart-icon