Recombinant Human MLST8 Protein, GST-tagged

• Cat.No.: MLST8-5397H
• Product Overview: Human MLST8 full-length ORF ( NP_071767.3, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MLST8 (MTOR Associated Protein, LST8 Homolog) is a Protein Coding gene. Diseases associated with MLST8 include Benign Familial Neonatal Epilepsy and Childhood Absence Epilepsy. Among its related pathways are CD28 co-stimulation and RET signaling.
• Molecular Mass: 62.3 kDa
• AA Sequence: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MLST8
• Synonyms: MLST8; MTOR associated protein, LST8 homolog (S. cerevisiae); target of rapamycin complex subunit LST8; G protein beta subunit like; GbetaL; GBL; Lst8; Pop3; gable; protein GbetaL; TORC subunit LST8; mammalian lethal with SEC13 protein 8; LST8; POP3; WAT1; MGC111011
• Gene ID: 64223
• mRNA Refseq: NM_001199173
• Protein Refseq: NP_001186102
• MIM: 612190
• UniProt ID: Q9BVC4