Recombinant Human MLX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MLX-2889H |
Product Overview : | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MLX MAX-like bHLHZIP protein [ Homo sapiens (human) ] |
Official Symbol | MLX |
Synonyms | MLX; MAX-like bHLHZIP protein; TCFL4; |
Gene ID | 6945 |
mRNA Refseq | NM_198205 |
Protein Refseq | NP_937848 |
MIM | 602976 |
UniProt ID | Q9UH92 |
◆ Recombinant Proteins | ||
MLX-5398H | Recombinant Human MLX Protein, GST-tagged | +Inquiry |
MLX-577H | Recombinant Human MLX Protein, MYC/DDK-tagged | +Inquiry |
MLX-3591H | Recombinant Human MLX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MLX-2619C | Recombinant Chicken MLX | +Inquiry |
MLX-6375HF | Recombinant Full Length Human MLX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLX-4287HCL | Recombinant Human MLX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLX Products
Required fields are marked with *
My Review for All MLX Products
Required fields are marked with *
0
Inquiry Basket