Recombinant Human MLXIP Protein, GST-tagged
Cat.No. : | MLXIP-5400H |
Product Overview : | Human MLXIP partial ORF ( NP_055753.2, 481 a.a. - 577 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes (Billin et al., 2000 [PubMed 11073985]).[supplied by OMIM |
Molecular Mass : | 36.41 kDa |
AA Sequence : | PSVITHTASATLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVHPKPVSLTGGRPKQPHKIVPAPKPEPVSLVLKNARIAP |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLXIP MLX interacting protein [ Homo sapiens ] |
Official Symbol | MLXIP |
Synonyms | MLXIP; MLX interacting protein; MLX-interacting protein; bHLHe36; KIAA0867; MIR; MONDOA; MondoA; Mlx interactor; transcriptional activator MondoA; class E basic helix-loop-helix protein 36; |
Gene ID | 22877 |
mRNA Refseq | NM_014938 |
Protein Refseq | NP_055753 |
MIM | 608090 |
UniProt ID | Q9HAP2 |
◆ Recombinant Proteins | ||
MLXIP-1116H | Recombinant Human MLXIP Protein (1-217 aa), His-SUMO-tagged | +Inquiry |
MLXIP-5400H | Recombinant Human MLXIP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLXIP Products
Required fields are marked with *
My Review for All MLXIP Products
Required fields are marked with *
0
Inquiry Basket