Recombinant Human MMACHC Protein, GST-tagged
Cat.No. : | MMACHC-5405H |
Product Overview : | Human MMACHC full-length ORF ( AAH06122.3, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The exact function of the protein encoded by this gene is not known, however, its C-terminal region shows similarity to TonB, a bacterial protein involved in energy transduction for cobalamin (vitamin B12) uptake. Hence, it is postulated that this protein may have a role in the binding and intracellular trafficking of cobalamin. Mutations in this gene are associated with methylmalonic aciduria and homocystinuria type cblC. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMACHC methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria [ Homo sapiens ] |
Official Symbol | MMACHC |
Synonyms | MMACHC; methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria; methylmalonic aciduria and homocystinuria type C protein; cblC; DKFZP564I122; FLJ25671; RP11-291L19.3; DKFZp564I122; |
Gene ID | 25974 |
mRNA Refseq | NM_015506 |
Protein Refseq | NP_056321 |
MIM | 609831 |
UniProt ID | Q9Y4U1 |
◆ Recombinant Proteins | ||
MMACHC-6386HF | Recombinant Full Length Human MMACHC Protein, GST-tagged | +Inquiry |
MMACHC-578H | Recombinant Human MMACHC Protein, MYC/DDK-tagged | +Inquiry |
MMACHC-2938C | Recombinant Chicken MMACHC | +Inquiry |
MMACHC-2607R | Recombinant Rhesus Macaque MMACHC Protein, His (Fc)-Avi-tagged | +Inquiry |
MMACHC-6487Z | Recombinant Zebrafish MMACHC | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMACHC-4284HCL | Recombinant Human MMACHC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMACHC Products
Required fields are marked with *
My Review for All MMACHC Products
Required fields are marked with *
0
Inquiry Basket