Recombinant Human MMP1 protein(111-290 aa), N-MBP & C-His-tagged

Cat.No. : MMP1-2535H
Product Overview : Recombinant Human MMP1 protein(P03956)(111-290 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&MBP
Protein Length : 111-290 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTI
Gene Name MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ]
Official Symbol MMP1
Synonyms MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN;
Gene ID 4312
mRNA Refseq NM_001145938
Protein Refseq NP_001139410
MIM 120353
UniProt ID P03956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP1 Products

Required fields are marked with *

My Review for All MMP1 Products

Required fields are marked with *

0
cart-icon