Recombinant Full Length Human MMP1 protein(20-469 aa), N-MBP & C-His-tagged
| Cat.No. : | MMP1-2536H |
| Product Overview : | Recombinant Human MMP1 protein(P03956)(20-469 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 20-469 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
| Gene Name | MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ] |
| Official Symbol | MMP1 |
| Synonyms | MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN; |
| Gene ID | 4312 |
| mRNA Refseq | NM_001145938 |
| Protein Refseq | NP_001139410 |
| MIM | 120353 |
| UniProt ID | P03956 |
| ◆ Recombinant Proteins | ||
| MMP1-1114H | Recombinant Full Length Human MMP1 Protein, His-tagged | +Inquiry |
| MMP1-568H | Recombinant Human MMP1 Protein, His-tagged | +Inquiry |
| MMP1-1116P | Recombinant Pig MMP1 Protein, His-tagged | +Inquiry |
| MMP1-91H | Recombinant Human MMP1 protein, T7/His-tagged | +Inquiry |
| MMP1-1713H | Active Recombinant Human MMP1 | +Inquiry |
| ◆ Native Proteins | ||
| MMP1-45H | Native Human MMP-1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP1-2884HCL | Recombinant Human MMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP1 Products
Required fields are marked with *
My Review for All MMP1 Products
Required fields are marked with *
