Recombinant Human MMP1 protein, His-tagged
| Cat.No. : | MMP1-2983H |
| Product Overview : | Recombinant Human MMP1 protein(428-469 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 428-469 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ] |
| Official Symbol | MMP1 |
| Synonyms | MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN; |
| Gene ID | 4312 |
| mRNA Refseq | NM_001145938 |
| Protein Refseq | NP_001139410 |
| MIM | 120353 |
| UniProt ID | P03956 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP1 Products
Required fields are marked with *
My Review for All MMP1 Products
Required fields are marked with *
