Recombinant Human MMP1 protein, His-tagged

• Cat.No.: MMP1-2983H
• Product Overview: Recombinant Human MMP1 protein(428-469 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 428-469 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ]
• Official Symbol: MMP1
• Synonyms: MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN
• Gene ID: 4312
• mRNA Refseq: NM_001145938
• Protein Refseq: NP_001139410
• MIM: 120353
• UniProt ID: P03956