"MMP1" Related Products

Expand

Recombinant Human MMP1 protein, T7/His-tagged

Cat.No.: MMP1-91H
Product Overview: Recombinant human MMP1 cDNA (100 – 469 aa, derived from BC013875), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVT PLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVM FFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGF PRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQY KFDPKTKRILTLQKANSWFNCRKN
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro activated MMP1 mediated extracellular matrix protein signal regulation study for various cell differentiation regulation with this protein as either coating matrix protein or soluble factor.2. May be used as MMP1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ]
Official Symbol: MMP1
Synonyms: MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN;
Gene ID: 4312
mRNA Refseq: NM_001145938
Protein Refseq: NP_001139410
MIM: 120353
UniProt ID: P03956
Chromosome Location: 11q21-q22
Pathway: Activation of Matrix Metalloproteinases, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem
Function: calcium ion binding; metalloendopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.