Recombinant Human MMP13 protein, His-tagged
| Cat.No. : | MMP13-7853H |
| Product Overview : | Recombinant Human MMP13 protein(100-471 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 100-471 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ] |
| Official Symbol | MMP13 |
| Synonyms | MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1; |
| mRNA Refseq | NM_002427 |
| Protein Refseq | NP_002418 |
| MIM | 600108 |
| UniProt ID | P45452 |
| Gene ID | 4322 |
| ◆ Recombinant Proteins | ||
| MMP13-443H | Recombinant Human matrix metallopeptidase 13 (collagenase 3), His-tagged | +Inquiry |
| MMP13-0833H | Recombinant Human MMP13 Protein (E103-N274), His tagged | +Inquiry |
| MMP13-2448H | Active Recombinant Human MMP13 protein, His-tagged | +Inquiry |
| MMP13-4451H | Recombinant Human MMP13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MMP13-27H | Active Recombinant Human MMP13 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *
