Recombinant Human MMP13 protein, T7/His-tagged
Cat.No. : | MMP13-92H |
Product Overview : | Recombinant human MMP13 cDNA (104 – 471 aa, derived from BC074807), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 104-471 a.a. |
Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVT PLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEF GHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGE TMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELG LPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQ FEYSIWSNRIVRVMPANSILWC |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro activated MMP13 mediated extracellular matrix protein signal regulation study for chondrocytes cell differentiation regulation or tumor cell metastasis with this protein as either coating matrix protein or soluble factor.2. May be used as MMP13 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ] |
Official Symbol | MMP13 |
Synonyms | MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1; |
Gene ID | 4322 |
mRNA Refseq | NM_002427 |
Protein Refseq | NP_002418 |
MIM | 600108 |
UniProt ID | P45452 |
Chromosome Location | 11q22.3 |
Pathway | Activation of Matrix Metalloproteinases, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Extracellular matrix organization, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem; |
Function | calcium ion binding; calcium-dependent protein binding; fibronectin binding; low-density lipoprotein particle receptor binding; metalloendopeptidase activity; peptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
Mmp13-506R | Recombinant Rat Mmp13 protein, His-tagged | +Inquiry |
Mmp13-1750M | Recombinant Mouse Mmp13 protein, His-tagged | +Inquiry |
MMP13-27H | Active Recombinant Human MMP13 protein | +Inquiry |
MMP13-5598M | Recombinant Mouse MMP13 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP13-1119C | Recombinant Cattle MMP13 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *
0
Inquiry Basket