Recombinant Human MMP13 protein, T7/His-tagged

Cat.No. : MMP13-92H
Product Overview : Recombinant human MMP13 cDNA (104 – 471 aa, derived from BC074807), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 104-471 a.a.
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVT PLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEF GHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGE TMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELG LPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQ FEYSIWSNRIVRVMPANSILWC
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro activated MMP13 mediated extracellular matrix protein signal regulation study for chondrocytes cell differentiation regulation or tumor cell metastasis with this protein as either coating matrix protein or soluble factor.2. May be used as MMP13 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ]
Official Symbol MMP13
Synonyms MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1;
Gene ID 4322
mRNA Refseq NM_002427
Protein Refseq NP_002418
MIM 600108
UniProt ID P45452
Chromosome Location 11q22.3
Pathway Activation of Matrix Metalloproteinases, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Extracellular matrix organization, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem;
Function calcium ion binding; calcium-dependent protein binding; fibronectin binding; low-density lipoprotein particle receptor binding; metalloendopeptidase activity; peptidase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP13 Products

Required fields are marked with *

My Review for All MMP13 Products

Required fields are marked with *

0
cart-icon