Recombinant Human MMP21 Protein, GST-tagged
Cat.No. : | MMP21-5427H |
Product Overview : | Human MMP21 partial ORF ( NP_671724.1, 374 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the matrix metalloproteinase family. Proteins in this family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction, and tissue remodeling,and disease processes, such as asthma and metastasis. The encoded protein may play an important role in embryogenesis, particularly in neuronal cells, as well as in lymphocyte development and survival. [provided by RefSeq |
Molecular Mass : | 37.62 kDa |
AA Sequence : | TRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMP21 matrix metallopeptidase 21 [ Homo sapiens ] |
Official Symbol | MMP21 |
Synonyms | MMP21; matrix metallopeptidase 21; matrix metalloproteinase 21; matrix metalloproteinase-21; MMP-21; |
Gene ID | 118856 |
mRNA Refseq | NM_147191 |
Protein Refseq | NP_671724 |
MIM | 608416 |
UniProt ID | Q8N119 |
◆ Recombinant Proteins | ||
MMP21-1882H | Recombinant Human MMP21 protein, His & T7-tagged | +Inquiry |
MMP21-2792R | Recombinant Rhesus monkey MMP21 Protein, His-tagged | +Inquiry |
mmp21-5432A | Recombinant African clawed frog mmp21 protein, His&Myc-tagged | +Inquiry |
MMP21-2613R | Recombinant Rhesus Macaque MMP21 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP21-5427H | Recombinant Human MMP21 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP21 Products
Required fields are marked with *
My Review for All MMP21 Products
Required fields are marked with *