Recombinant Human MMP21 Protein, GST-tagged

Cat.No. : MMP21-5427H
Product Overview : Human MMP21 partial ORF ( NP_671724.1, 374 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the matrix metalloproteinase family. Proteins in this family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction, and tissue remodeling,and disease processes, such as asthma and metastasis. The encoded protein may play an important role in embryogenesis, particularly in neuronal cells, as well as in lymphocyte development and survival. [provided by RefSeq
Molecular Mass : 37.62 kDa
AA Sequence : TRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMP21 matrix metallopeptidase 21 [ Homo sapiens ]
Official Symbol MMP21
Synonyms MMP21; matrix metallopeptidase 21; matrix metalloproteinase 21; matrix metalloproteinase-21; MMP-21;
Gene ID 118856
mRNA Refseq NM_147191
Protein Refseq NP_671724
MIM 608416
UniProt ID Q8N119

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP21 Products

Required fields are marked with *

My Review for All MMP21 Products

Required fields are marked with *

0
cart-icon