Recombinant Human MMP3 protein, His-SUMO-tagged
Cat.No. : | MMP3-3235H |
Product Overview : | Recombinant Human MMP3 protein(P08254)(102-477aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 102-477aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.5 kDa |
AA Sequence : | TFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) [ Homo sapiens ] |
Official Symbol | MMP3 |
Synonyms | MMP3; matrix metallopeptidase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3 (stromelysin 1, progelatinase) , STMY, STMY1; stromelysin-1; transin-1; proteoglycanase; matrix metalloproteinase-3; matrix metalloproteinase 3 (stromelysin 1, progelatinase); SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; MGC126102; MGC126103; MGC126104; |
Gene ID | 4314 |
mRNA Refseq | NM_002422 |
Protein Refseq | NP_002413 |
MIM | 185250 |
UniProt ID | P08254 |
◆ Recombinant Proteins | ||
MMP3-5433H | Recombinant Human MMP3 Protein, GST-tagged | +Inquiry |
MMP3-3235H | Recombinant Human MMP3 protein, His-SUMO-tagged | +Inquiry |
MMP3-0392H | Active Recombinant Human MMP3 protein, His-tagged | +Inquiry |
MMP3-39H | Recombinant Human MMP3 | +Inquiry |
MMP3-200H | Active Recombinant Human MMP3, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP3-4273HCL | Recombinant Human MMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP3 Products
Required fields are marked with *
My Review for All MMP3 Products
Required fields are marked with *
0
Inquiry Basket