Recombinant Human MMP7 protein(18-267 aa), N-SUMO & C-His-tagged
Cat.No. : | MMP7-2612H |
Product Overview : | Recombinant Human MMP7 protein(P09237)(18-267 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 18-267 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
Gene Name | MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ] |
Official Symbol | MMP7 |
Synonyms | MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1; |
Gene ID | 4316 |
mRNA Refseq | NM_002423 |
Protein Refseq | NP_002414 |
MIM | 178990 |
UniProt ID | P09237 |
◆ Recombinant Proteins | ||
Mmp7-10595M | Recombinant Mouse Mmp7 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP7-48H | Recombinant Human MMP7 protein, His-tagged | +Inquiry |
MMP7-222H | Recombinant Human MMP7 Protein (Met1-Lys276), C-His tagged, Animal-free, Carrier-free | +Inquiry |
MMP7-3718R | Recombinant Rat MMP7 Protein | +Inquiry |
MMP7-01H | Active Recombinant Human MMP7 Protein | +Inquiry |
◆ Native Proteins | ||
MMP7-28205TH | Native Human MMP7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP7-2883HCL | Recombinant Human MMP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP7 Products
Required fields are marked with *
My Review for All MMP7 Products
Required fields are marked with *