Recombinant Human MMP7 protein(18-267 aa), N-SUMO & C-His-tagged

• Cat.No.: MMP7-2612H
• Product Overview: Recombinant Human MMP7 protein(P09237)(18-267 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 18-267 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

Gene Information

• Gene Name: MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ]
• Official Symbol: MMP7
• Synonyms: MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1
• Gene ID: 4316
• mRNA Refseq: NM_002423
• Protein Refseq: NP_002414
• MIM: 178990
• UniProt ID: P09237